PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv9_207000_nzcd.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family EIL
Protein Properties Length: 619aa    MW: 70578.7 Da    PI: 5.6329
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv9_207000_nzcd.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3485.14.1e-148484261353
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         eel+++mw+d+m+lkrlke+++     ++  ++a+k+++s+eq+rrkkmsr QDgiLkYMlk+mevcnaqGfvYgiipekgkpv gasd+L
  Bv9_207000_nzcd.t1  48 EELERKMWRDKMRLKRLKEQNRV----NKG-FDARKNHQSQEQSRRKKMSRVQDGILKYMLKMMEVCNAQGFVYGIIPEKGKPVGGASDNL 133
                         8*******************997....445.9*********************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         r+WWk+kv+fdrngpaai+kyqa++ i++ +++ ++    ++ +l++lqDTtlgSLLsalmqhc+ppqrrfplekgv+pPWWPtGke+ww+
  Bv9_207000_nzcd.t1 134 REWWKDKVRFDRNGPAAIAKYQADHFISGANEEFNS-VGPTPVTLQDLQDTTLGSLLSALMQHCNPPQRRFPLEKGVPPPWWPTGKEEWWH 223
                         *****************************9999977.999*************************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXXX CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.slrkq 270
                         +lgl+kd g+ppykkphdlkkawkvsvLtavikhmsp+i++i++l+rqsk+lqdkm+akes+++l+++n+e+ ++++++++  ++ ++  +
  Bv9_207000_nzcd.t1 224 QLGLPKDYGPPPYKKPHDLKKAWKVSVLTAVIKHMSPDIAKINKLVRQSKCLQDKMTAKESATWLAIINHEDVLARELYPDccPHlTSAGG 314
                         *********************************************************************************843344455* PP

                         XXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX...............................XXXXXXXXXXXXXXXXXXXXX......X CS
                EIN3 271 spkvtlsceqkedvegkkeskikhvqavktta...............................gfpvvrkrkkkpsesakvsskevsrtcq 330
                         s ++ ++++ ++dveg +++   +v ++k ++                                ++  rkrk  + e+ k   ++ ++ c 
  Bv9_207000_nzcd.t1 315 SGSFMINDSGEYDVEGARDKPNLNVLEKKLADnessdlgrekrfkghplisqlsnlnseekvcVMDNSRKRK--SFEQFKDRMNQQIYVCG 403
                         ***************655555455555555456999**********************99855555555555..5555555555558**** PP

                         XXXXXX.XXXXXXXXXXXXXXXX CS
                EIN3 331 ssqfrgsetelifadknsisqne 353
                           ++++++ el+f d+ s+++++
  Bv9_207000_nzcd.t1 404 LVECPHNQLELGFYDRISRDNHQ 426
                         *********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.0E-12848294No hitNo description
Gene3DG3DSA:1.10.3180.103.9E-73169305IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167689.55E-61175298IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MMFAEMSLCG GDVEFSSTPT LAADIAASQV NPGDIMVDEY SDEEMDVEEL ERKMWRDKMR  60
LKRLKEQNRV NKGFDARKNH QSQEQSRRKK MSRVQDGILK YMLKMMEVCN AQGFVYGIIP  120
EKGKPVGGAS DNLREWWKDK VRFDRNGPAA IAKYQADHFI SGANEEFNSV GPTPVTLQDL  180
QDTTLGSLLS ALMQHCNPPQ RRFPLEKGVP PPWWPTGKEE WWHQLGLPKD YGPPPYKKPH  240
DLKKAWKVSV LTAVIKHMSP DIAKINKLVR QSKCLQDKMT AKESATWLAI INHEDVLARE  300
LYPDCCPHLT SAGGSGSFMI NDSGEYDVEG ARDKPNLNVL EKKLADNESS DLGREKRFKG  360
HPLISQLSNL NSEEKVCVMD NSRKRKSFEQ FKDRMNQQIY VCGLVECPHN QLELGFYDRI  420
SRDNHQLTCP YQSSNLPYGI PNYQVNEVKP SAFQRQALQD EHAALPSNSA QPVFDLSGLE  480
VPEDGQKMIS ELMSYYDSNI LATKTPYHEI ISPADHNVMQ RSMDYNQNDL ILRPSSITEL  540
NLPDQYDIQV HHQMLNWQEE NKFSGCEQLE HDLSVNGLDS ILKVQLDLPY TDFMEDLPSG  600
TSTACLKQDP STWYNNNII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B3e-781733042133Protein ETHYLENE INSENSITIVE 3
4zds_A3e-781733042133Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1381386SRKRKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010689360.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0J8BLA90.0A0A0J8BLA9_BETVU; Uncharacterized protein
STRINGGLYMA13G03700.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein